From patchwork Wed Nov 9 16:38:23 2016 Content-Type: text/plain; charset="utf-8" MIME-Version: 1.0 Content-Transfer-Encoding: 8bit X-Patchwork-Submitter: =?utf-8?q?Vincent_Stehl=C3=A9?= X-Patchwork-Id: 692851 Return-Path: X-Original-To: incoming@patchwork.ozlabs.org Delivered-To: patchwork-incoming@bilbo.ozlabs.org Received: from hemlock.osuosl.org (smtp2.osuosl.org [140.211.166.133]) (using TLSv1.2 with cipher AECDH-AES256-SHA (256/256 bits)) (No client certificate requested) by ozlabs.org (Postfix) with ESMTPS id 3tDX1d0mwSz9vFH for ; Thu, 10 Nov 2016 03:38:45 +1100 (AEDT) Authentication-Results: ozlabs.org; dkim=fail reason="signature verification failed" (2048-bit key; unprotected) header.d=laposte.net header.i=@laposte.net header.b="W0Ln0vUT"; dkim-atps=neutral Received: from localhost (localhost [127.0.0.1]) by hemlock.osuosl.org (Postfix) with ESMTP id 4EDC3956D8; Wed, 9 Nov 2016 16:38:42 +0000 (UTC) X-Virus-Scanned: amavisd-new at osuosl.org Received: from hemlock.osuosl.org ([127.0.0.1]) by localhost (.osuosl.org [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id M6HAWoC-GN8q; Wed, 9 Nov 2016 16:38:40 +0000 (UTC) Received: from ash.osuosl.org (ash.osuosl.org [140.211.166.34]) by hemlock.osuosl.org (Postfix) with ESMTP id 1B1B1956CC; Wed, 9 Nov 2016 16:38:40 +0000 (UTC) X-Original-To: buildroot@lists.busybox.net Delivered-To: buildroot@osuosl.org Received: from whitealder.osuosl.org (smtp1.osuosl.org [140.211.166.138]) by ash.osuosl.org (Postfix) with ESMTP id 656F31CF7FD for ; Wed, 9 Nov 2016 16:38:38 +0000 (UTC) Received: from localhost (localhost [127.0.0.1]) by whitealder.osuosl.org (Postfix) with ESMTP id 60DD39193E for ; Wed, 9 Nov 2016 16:38:38 +0000 (UTC) X-Virus-Scanned: amavisd-new at osuosl.org Received: from whitealder.osuosl.org ([127.0.0.1]) by localhost (.osuosl.org [127.0.0.1]) (amavisd-new, port 10024) with ESMTP id p2+G7UDA72qR for ; Wed, 9 Nov 2016 16:38:35 +0000 (UTC) X-Greylist: domain auto-whitelisted by SQLgrey-1.7.6 Received: from smtp.laposte.net (smtpoutz27.laposte.net [194.117.213.102]) by whitealder.osuosl.org (Postfix) with ESMTPS id 005E28B3D5 for ; Wed, 9 Nov 2016 16:38:34 +0000 (UTC) Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout015 (Postfix) with ESMTP id C19361C93EE for ; Wed, 9 Nov 2016 17:38:32 +0100 (CET) DKIM-Signature: v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail0; t=1478709512; bh=VTyEsPiBykiW/QXA6D0vXtq1+jB0W71CRT8IW9k9hHs=; h=From:To:Cc:Subject:Date:In-Reply-To:References; b=W0Ln0vUTL9KQ5TdMOsxJMfN27PhiaSu+vgh9HpNb1TltiIq2vdn4N8UxkwJr8e4a1 e4sGdAE4YVfaazi5rPSBnMdf+/KqB7lr+Jl1x34uknrklIf8B+x+KHQy7AljnSZdnH QYy14LFwTcblsZ3JuKe3AXzzs7mGBjUMN2u4XeSsSaKpsqL9PvLqhHniNbTQtwseev KKWzEsK/vIAYJdJMeEjOlNGbm7VUXAJ4Y81qQmpfkIeMOcb1TEMOsXb7gW5KJzsMbx TDn3GxNbbcizMCAFXn1zMXS+EYIu+8lpIu9PYRVl/jTMsBkC6bFcR4vr4mEZRFroQu 1uZ1l2ntxW5mw== Received: from smtp.laposte.net (localhost [127.0.0.1]) by lpn-prd-vrout015 (Postfix) with ESMTP id B3A4D1C94D1 for ; Wed, 9 Nov 2016 17:38:32 +0100 (CET) Received: from lpn-prd-vrin001 (lpn-prd-vrin001.laposte [10.128.63.2]) by lpn-prd-vrout015 (Postfix) with ESMTP id AECEE1C93EE for ; Wed, 9 Nov 2016 17:38:32 +0100 (CET) Received: from lpn-prd-vrin001 (localhost [127.0.0.1]) by lpn-prd-vrin001 (Postfix) with ESMTP id 98E6E366CFF for ; Wed, 9 Nov 2016 17:38:32 +0100 (CET) Received: from romuald.bergerie (rqp06-1-88-178-86-202.fbx.proxad.net [88.178.86.202]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by lpn-prd-vrin001 (Postfix) with ESMTPSA id 5BAAE366C9C; Wed, 9 Nov 2016 17:38:32 +0100 (CET) Received: from radicelle.bergerie (radicelle.bergerie [192.168.124.12]) by romuald.bergerie (Postfix) with ESMTPS id A25441820E44; Wed, 9 Nov 2016 17:38:31 +0100 (CET) Received: from vincent by radicelle.bergerie with local (Exim 4.87) (envelope-from ) id 1c4VtP-0000pb-IT; Wed, 09 Nov 2016 17:38:31 +0100 From: Vincent Stehle To: buildroot@buildroot.org Date: Wed, 9 Nov 2016 17:38:23 +0100 Message-Id: <20161109163823.25501-1-vincent.stehle@laposte.net> X-Mailer: git-send-email 2.10.2 In-Reply-To: <20161105143516.00291507@free-electrons.com> References: <20161105143516.00291507@free-electrons.com> MIME-Version: 1.0 X-VR-SrcIP: 88.178.86.202 X-VR-FullState: 0 X-VR-Score: -100 X-VR-Cause-1: gggruggvucftvghtrhhoucdtuddrfeelfedrtddtgdeivdcutefuodetggdotefrodftvfcurfhrohhf X-VR-Cause-2: ihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecusecvtfgvtghiphhivghnthhs X-VR-Cause-3: ucdlqddutddtmdenucfjughrpefhvffufffkofgjfhggtgfgsehtkeertdertdejnecuhfhrohhmpegg X-VR-Cause-4: ihhntggvnhhtucfuthgvhhhlvgcuoehvihhntggvnhhtrdhsthgvhhhlvgeslhgrphhoshhtvgdrnhgv X-VR-Cause-5: theqnecuffhomhgrihhnpehfrhgvvghstggrlhgvrdgtohhmnecukfhppeekkedrudejkedrkeeirddv X-VR-Cause-6: tddvnecurfgrrhgrmhepmhhouggvpehsmhhtphhouhhtpdhhvghloheprhhomhhurghlugdrsggvrhhg X-VR-Cause-7: vghrihgvpdhinhgvthepkeekrddujeekrdekiedrvddtvddpmhgrihhlfhhrohhmpehvihhntggvnhht X-VR-Cause-8: rdhsthgvhhhlvgeslhgrphhoshhtvgdrnhgvthdprhgtphhtthhopehfrggsihhordgvshhtvghvrghm X-VR-Cause-9: sehngihprdgtohhm X-VR-AvState: No X-VR-State: 0 X-VR-State: 0 Cc: Thomas Petazzoni , Fabio Estevam , =?UTF-8?q?Vincent=20Stehl=C3=A9?= Subject: [Buildroot] [PATCH] configs: freescale_imx31_3stack: bump kernel version to 4.1.15_2.0.0_ga X-BeenThere: buildroot@busybox.net X-Mailman-Version: 2.1.18-1 Precedence: list List-Id: Discussion and development of buildroot List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Errors-To: buildroot-bounces@busybox.net Sender: "buildroot" From: Vincent Stehlé Switch to the kernel of release 4.1.15_2.0.0_ga, as it builds properly with gcc 5.x, which is now the default. We add a linux config fragment to disable the framebuffer, to repair the build for imx_v6_v7_defconfig. Suggested-by: Thomas Petazzoni Signed-off-by: Vincent Stehlé Signed-off-by: Julien Olivain Tested-by: Julien Olivain Cc: Fabio Estevam --- Hello Thomas and Fabio, My friend Julien got the i.MX31 PDK and he could kindly test a few buildroot configs! His experiments show that mainline kernel will not boot "as is" on the PDK. What he proposed instead is that we switch to a recent NXP/Freescale release based on kernel 4.1, which does boot on the PDK. Is that proposal fine with you, please? Best regards, Vincent. board/freescale/imx31_3stack/linux.fragment | 1 + configs/freescale_imx31_3stack_defconfig | 12 ++++++------ 2 files changed, 7 insertions(+), 6 deletions(-) create mode 100644 board/freescale/imx31_3stack/linux.fragment diff --git a/board/freescale/imx31_3stack/linux.fragment b/board/freescale/imx31_3stack/linux.fragment new file mode 100644 index 0000000..8d89e8e --- /dev/null +++ b/board/freescale/imx31_3stack/linux.fragment @@ -0,0 +1 @@ +CONFIG_FB_MXS=n diff --git a/configs/freescale_imx31_3stack_defconfig b/configs/freescale_imx31_3stack_defconfig index bf1afad..0476fc1 100644 --- a/configs/freescale_imx31_3stack_defconfig +++ b/configs/freescale_imx31_3stack_defconfig @@ -3,18 +3,18 @@ BR2_arm=y BR2_arm1136jf_s=y BR2_ARM_EABIHF=y -# Linux headers same as kernel, a 3.15 series -BR2_PACKAGE_HOST_LINUX_HEADERS_CUSTOM_3_15=y +# Linux headers same as kernel, a 4.1 series +BR2_PACKAGE_HOST_LINUX_HEADERS_CUSTOM_4_1=y # system BR2_TARGET_GENERIC_GETTY_PORT="ttymxc0" # kernel BR2_LINUX_KERNEL=y -# Note: sadly the Linux kernel will not boot on the i.MX31 PDK, starting with -# v3.16 and at least up to v4.0-rc4; this is why we use v3.15.y here. -BR2_LINUX_KERNEL_CUSTOM_VERSION=y -BR2_LINUX_KERNEL_CUSTOM_VERSION_VALUE="3.15.10" +BR2_LINUX_KERNEL_CUSTOM_GIT=y +BR2_LINUX_KERNEL_CUSTOM_REPO_URL="git://git.freescale.com/imx/linux-imx.git" +BR2_LINUX_KERNEL_CUSTOM_REPO_VERSION="rel_imx_4.1.15_2.0.0_ga" BR2_LINUX_KERNEL_DEFCONFIG="imx_v6_v7" +BR2_LINUX_KERNEL_CONFIG_FRAGMENT_FILES="board/freescale/imx31_3stack/linux.fragment" BR2_TARGET_ROOTFS_CPIO_GZIP=y BR2_TARGET_ROOTFS_INITRAMFS=y